PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c4_6990V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 2636aa    MW: 282788 Da    PI: 5.4533
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c4_6990V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.1e-0912161259347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                         WT  E el+ +av+++  + +++Ia+++g ++++ qcks++ k 
  Pp3c4_6990V3.2.p 1216 QWTDKERELFTEAVRLFRRD-FESIAAHVGSTKSEGQCKSFFSKT 1259
                        5*****************77.*********99*********9886 PP

2Myb_DNA-binding32.81.6e-1017521793346
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                        +WT+eE e ++d ++ +G++ W++  ++++ +++l q+k ++q+
  Pp3c4_6990V3.2.p 1752 SWTQEEKEVFADIIRNHGKD-WTRLHECLP-TKSLTQIKTYFQN 1793
                        7*****************99.*********.************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.83E-139621025IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-59691018IPR009057Homeodomain-like
PROSITE profilePS5129317.1799741025IPR017884SANT domain
SMARTSM007171.1E-79751023IPR001005SANT/Myb domain
PROSITE profilePS5129315.72712121264IPR017884SANT domain
SMARTSM007171.3E-712131262IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-812161267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-412161261IPR009057Homeodomain-like
PfamPF002491.3E-712161258IPR001005SANT/Myb domain
CDDcd001672.83E-512171256No hitNo description
SuperFamilySSF466892.69E-1017471797IPR009057Homeodomain-like
PROSITE profilePS512938.25817481799IPR017884SANT domain
SMARTSM007173.8E-817491797IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-717501794IPR009057Homeodomain-like
CDDcd001677.70E-617521795No hitNo description
PfamPF002498.2E-817521793IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2636 aa     Download sequence    Send to blast
MYSPGRGDAR ATALPNARDS STSMPIDHSS AWQREPYNRD VRLDRGDRER TIGGKREWNS  60
DRASPGAPYQ RGFGGLHPVN GYLGPPSKRR LNGRHIGFHA GNGRYGSAGQ RGEPSFGSFV  120
PLENGLAPKF EQESFYLGSG RPVVNTGFSS GPGLDYRSKE LGERQRKGSF LTSGDGRDGG  180
SSGVNVQHVR LYPSQVLTEV ENTSWERERP KGQDGNGWES SQRSEREHRE RLLGKAESFS  240
RREGRFSQFE EGRERSQVDK DSDGSKLDRC GSSSWDRCSG DTMCGSKVSA NGFDWRRKER  300
STSVSASRNA SNGCSKESVV RPPVLDVSGS PSSPQLSLRS TPSALVEVSR DDGNHPSPAK  360
RPRLGWGQGL AKYEKKNEVV ETDDIFVSGS VDSASGSKRS SVTAVSGVKT EVVQMLGLQA  420
AEESSVSVIS KLSTLPLPKV SSSPLQKALE TGVSKSSVES RAVEEVLGKA CEMVADEAVR  480
SSSNFTTPGV RAEDLVKTAD VCALTECSLE LSVRQSYSWE PVEKPTAWKE SNSCQASPTV  540
PCSVEQCCGV EVTQEVCSTG DTTWWSKEDI LQRVEKLESE IEQVERELST SKRFGSLRND  600
THMPVPEIFE NSANADLGTK LEPGDYGPQV LADNAVSSHA GSMECRDSSQ LILVSFPNRI  660
CSVSAECISH SVSSLETGAA VGAGPPMCNQ AMGSKHRNME NEVLVMEEWQ SHEGEKEATS  720
DQTMVESEGE GSLVSSPSAE VYLPHMTLRE RAGVEVRVSK SAIAKMESSD AAMVVGDVEA  780
VARGLIGENK DQARHASEAF LHLLSQGGRG EGKVYSCPVE APVWKENVER HVRNQEKMLE  840
KIAERRQSAR FVEQVLTIKF RALKDAWRQE QFGTSQQQRG TKPVRRWEAE KRGGTAGCHR  900
SSLRLRPVQA GGGKLEAQSE ESMKRVMVEP VVGPLRPALK MPAMILGERE RLARRFESNN  960
ALVEDPVRVE SERKSMNPWS AEERRVFLEK FAVYNKNFSK IASHLEYKTT ADCVEFYCRN  1020
QKSEDFEKIR RRQQLQKRRD CSRLGGSFLS TGLQPNSRQR EANIDARSEG WNMQTSGAVS  1080
TVCQITVGAK AARSSTHHKP LERQRTSSSL DPGSLPAVVE IAKSTSGKES RPSGIPPLPS  1140
GAAGSGTTGS CSLSSATAAS VKVSRERTSV KSNWNGGSAV ARSGTKEQQM SGPKGARSVN  1200
IRRGLTTSAG EETDAQWTDK ERELFTEAVR LFRRDFESIA AHVGSTKSEG QCKSFFSKTR  1260
KRLRLDQLVE KHQAALNFSA DAAVAESPEC IDVQMEEVPG AAAEVVLVAS LEANIYPSLG  1320
EEKVWNEATE SGKVEEVAND VSIQATEAVE AEMCEDIAAE KTVEEESCED VVVAKAVEEG  1380
LCEGVAIERA GKEEIFDNAA VHKAVEEVLS EDVKVEMAVK EETVEDVAIV MAVEDALSEV  1440
VSDEKAVEEV LSEDLLDEKA MEDGSIEEKA GEDGSIEEKA GEDGSVEVKT VENEGVVRKA  1500
VEHGAVKDVV VDDETVDDVA EEGVVGVIEV VETVDFVGVS MDLTVESAVC PLESPDIVEN  1560
LEKAEADVGA GACSMNECDT GEAEDVVAAC IKAEPVVVDE GVVSEPLTVD AGEELPAGNS  1620
SGSSADCGMQ EEGDAVEVAK GAESVVESVK REVDAGDDKG LGTVVATSIL ASEEQIVEAS  1680
GAVDVKHQAG SPQMAVSTGT ESGSCAIGAE GACHSGKAAY ATTSSMHGSQ QCREKSGRVG  1740
SGEAKSRREP TSWTQEEKEV FADIIRNHGK DWTRLHECLP TKSLTQIKTY FQNSKAKLGL  1800
VNSEGVSVGG GRGSGSRKRK AEEVDNMSNN VGCVNGRIES KCGSVSGGDV DGGGQKVKGG  1860
MGDPPSMSVS AGMGTIPVGL EGLAYPFFGQ RVEDQMALHQ FIRQLQLCNP NGFPQNIPPM  1920
LHPLLQQQGL GVFPDPGLQR AGPPNLQQQF AASMSQKTSQ SMGLQLALQG PGVGQQSGAV  1980
DLHQQGAHQL LNSQAARSQQ QLLANMMQQQ AAAQLQQQQH PCSKSVVHSL QQAVLLQPGQ  2040
VAQRQQQQLM SPQVVHHSQA HQAGGQHQQY QALLQHQQFQ QTVQHFQQQQ DHVQAQALIH  2100
QHHSSHAPLP PSLVSSSKSI AVMPLPQHLS KIPLAPVLQQ GIAVHEERNG AGVTSSRVNE  2160
GSAGSSHCED ASIQQVESGE LRGSCSNGGP RGQDFSRAEF HQLSGAVQRA PPSQTAVPLR  2220
PSPISATESP QTRPGDVKLF GQSLLSQPTC SAGLQSAARA APCATDKVSL QQSPVHTMTL  2280
SSTTGTSVPA ATVSKVYGSE TSFGGMSSMS DGRQSIWPSL GNLGSIETRN IANGMHLQAG  2340
PLWKSKERES KLHNMQESRM FREARDAEPG QSTPTNSYKL QPLEHSRNIQ EHSRSEGFPS  2400
LNNPGFYLNE QGGGGGFSVS SVEASRPELE RRNESSSIGS SGCERGPSTC GRSSRGQMDS  2460
FAMKAAGLLA NGPQVPRTMM NSLMAVADLH QSRSLLSGIG SPRLEDHQCG NFIRQAANGA  2520
AVDTLKADAS VGLAGPLAAP QAHLSGGDLL QQCVRDSGMY FTQHYSHLAD HPGVSPGAWY  2580
AGTGLMHPSD VQRMLVNPAL NPFLLGALSR APSAAEEHLG SIESRDPDNG GSGLR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D5e-159331027194NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C5e-159331027194NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.178760.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001771897.10.0predicted protein
TrEMBLA9SZT20.0A9SZT2_PHYPA; Predicted protein
STRINGPP1S143_55V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP32151725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.12e-33MYB family protein